missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HIV-2 gp-36 397aa Protein

A cDNA sequence encoding the HIV-2 gp-36 397aa was constructed and used to recombinantly synthesize the protein.

232.00€ - 1810.00€

Especificaciones

Nombre HIV-2 gp-36 397aa Protein
Tipo de producto Recombinant Protein
Etiqueta de proteína Untagged
Especie del huésped E. coli
reactividad cruzada HIV
Ver más especificaciones

Productos 3
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
15989888
Ver documentos Detalles de la promoción
enQuireBio™
QP12270-100UG
100 μg
232.00€
100 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 12-08-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
15909898
Ver documentos Detalles de la promoción
enQuireBio™
QP12270-500UG
500 μg
905.00€
500 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 12-08-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
15999888
Ver documentos Detalles de la promoción
enQuireBio™
QP12270-1MG
1 mg
1810.00€
1 miligramo
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 12-08-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

Especificaciones

Especificaciones

HIV-2 gp-36 397aa Protein
Untagged
HIV
Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.
Recombinant Protein
E. coli
EQTMVQDDPSTCRGEFLYCNMTWFLNWIENKTHRNYAPCHIKQIINTWHKVGRNVYLPPREGELSCNSTVTSIIANIDWQNNNQTNITFSAEVAELYRLELGDYKLVEITPIGFAPTKEKRYSSAHGRHTRGVFVLGFLGFLATAGSAMGAASLTVSAQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQARVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDSLAPDWDNMTWQEWEKQVRYLEANISKSLEQAQIQQEKNMYELQKLNSWDIFGNWFDLTSWVKYIQYGVLIIVAVIALRIVIYVVQMLSRLRKGYRPVFSSPPGYIQQIHIHKDRGQPANEETEEDGGSNGGDRYWPWPIAYIHFLIRQLIRLLTRLYSICSQAC
SDS
Product Certifications