Learn More
Invitrogen™ Human IP3 Receptor 1 (aa 1864-1998) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP91254
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Intracellular channel that mediates calcium release from the endoplasmic reticulum following stimulation by inositol 1,4,5-trisphosphate. Involved in the regulation of epithelial secretion of electrolytes and fluid through the interaction with AHCYL1. Plays a role in ER stress-induced apoptosis. Cytoplasmic calcium released from the ER triggers apoptosis by the activation of CaM kinase II, eventually leading to the activation of downstream apoptosis pathways.
Especificaciones
Q14643 | |
Blocking Assay, Control | |
3708 | |
100 μL | |
ACV; CLA4; D6Pas2; ENSMUSG00000072853; Gm10429; I145TR; inositol 1,4,5-triphosphate receptor 1; inositol 1,4,5-triphosphate receptor, type 1; inositol 1,4,5-trisphosphate receptor 1; inositol 1,4,5-trisphosphate receptor type 1; inositol 1,4,5-trisphosphate receptor, type 1; inositol 1,4,5-trisphosphate-binding protein P400; Insp3r; InsP3R type I; insP3R1; IP3 receptor; IP3 receptor isoform 1; Ip3r; IP-3-R; IP3R 1; IP3R1; Itpr1; Itpr-1; opisthotonus; opt; P400; Pcd6; Pcp1; Pcp-1; PPP1R94; protein PCD-6; protein phosphatase 1, regulatory subunit 94; Purkinje cell protein 1; SCA15; SCA16; SCA29; SI-SIII-SIIA; Type 1 inositol 1,4,5-trisphosphate receptor; type 1 InsP3 receptor | |
Itpr1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human IP3 Receptor 1 (aa 1864-1998) Control Fragment | |
RUO | |
IP3 Receptor 1 | |
Unconjugated | |
Recombinant | |
FFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQPGEGTQATADKAKDDLEMSAVITIMQPILRFLQLLCENHNRDLQNFLRC | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Sugerencias de productos
Customers who viewed this item also viewed.
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.