Learn More
Invitrogen™ Human IL-37 Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP96069
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (24%), Rat (24%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63505 (PA5-63505. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine can bind to, and may be a ligand for interleukin 18 receptor (IL18R1/IL-1Rrp). This cytokine also binds to interleukin 18 binding protein (IL18BP), an inhibitory binding protein of interleukin 18 (IL18), and subsequently forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL18. This gene along with eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Five alternatively spliced transcript variants encoding distinct isoforms have been reported.
Especificaciones
Q9NZH6 | |
Blocking Assay, Control | |
27178 | |
100 μL | |
FIL1; FIL1 zeta; FIL1(ZETA); FIL1Z; IL-1 zeta; IL1F7; IL-1F7; IL1F7 (canonical product IL-1F7b); IL-1F7b (IL-1H4, IL-1 H, IL-1 RP1); IL-1 H; IL1H4; IL-1H4; IL1RP1; IL-1 RP1; IL-1 X; IL-1 x protein; IL37; IL-37; ILN; Interleukin; interleukin 1 family member 7; interleukin 1, zeta; interleukin 37; Interleukin-1 family member 7; Interleukin-1 homolog 4; interleukin-1 superfamily z; Interleukin-1 zeta; Interleukin-1-related protein; interleukin-23; Interleukin37; Interleukin-37 | |
IL37 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human IL-37 Control Fragment | |
RUO | |
IL-37 | |
Unconjugated | |
Recombinant | |
ENSGVKMGSEDWEKDEPQCCLEDPAVSPLEPGPSLPAMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALA | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Sugerencias de productos
Customers who viewed this item also viewed.
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.