missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CCL20 (P78556, 27 a.a. - 96 a.a.) Partial Recombinant Protein
Used for Func, SDS-PAGE
Marca: Abnova™ P3654.25ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNMEspecificaciones
P78556 | |
Lyophilized | |
8kDa | |
Escherichia coli expression system | |
25 μg | |
Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing. | |
<0.1ng/μg (1 EU/μg) | |
CCL20 | |
Determined by its ability to chemoattract human monocytes using a concentration range of 2.0-40.0ng/mL. | |
Recombinant | |
Escherichia coli expression system | |
>90% by SDS-PAGE and HPLC |
Functional Study, SDS-PAGE | |
6364 | |
CCL20 (Human) Recombinant Protein | |
Ion exchange column and HPLC reverse phase column | |
ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM | |
RUO | |
CKb4/LARC/MIP-3a/MIP3A/SCYA20/ST38 | |
CCL20 | |
E. coli | |
None | |
Lyophilized |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Abnova™ Human CCL20 (P78556, 27 a.a. - 96 a.a.) Partial Recombinant Protein > 25μg
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido