UserName
Bio-Techne es un desarrollador, fabricante y proveedor mundial de reactivos, instrumentos analíticos y diagnósticos de precisión de alta calidad. Tanto si se encuentra en la vanguardia de la investigación académica, traduciendo descubrimientos básicos en pistas terapéuticas, o en una instalación que requiere el más alto nivel de pruebas de diagnóstico, nuestras galardonadas herramientas y soluciones permiten a los científicos y médicos lograr resultados reproducibles y consistentes. Elegir Bio-Techne significa tener la confianza de que cada solución que utilice le ayudará a avanzar hacia mejores respuestas.
Una nota de aplicación que demuestra el valor de las proteínas de R&D Systems™ para lograr condiciones de cultivo de organoides robustas y reproducibles.
Desarrolle su potencial proteínico y celular
Progresos, retos y un futuro apasionante
París, Francia 01-05-2024
Thermo Fisher Scientific, proveedor líder de productos y servicios de laboratorio, se complace en anunciar un hito importante en su compromiso de ofrecer soluciones de vanguardia a sus clientes. A partir del 1 de mayo de 2024, Thermo Fisher firmará un acuerdo estratégico de distribución en Europa con Bio-Techne (NASDAQ: TECH), una compañía global de ciencias de la vida que proporciona herramientas innovadoras y reactivos bioactivos para las comunidades de investigación y diagnóstico clínico.
Esta asociación marca una importante colaboración entre dos líderes de la industria en los campos de la investigación científica, el diagnóstico y la biotecnología. En virtud de este acuerdo, Thermo Fisher, a través del canal Fisher Scientific, Europa, distribuirá la amplia cartera de productos innovadores de Bio-Techne, que incluye anticuerpos, proteínas, kits de inmunoensayo, reactivos y enzimas a laboratorios e instituciones de investigación de toda Europa.
"We are thrilled to forge this partnership with Bio-Techne, a company renowned for its pioneering advancements in the life sciences industry," said Claire Wallace, President, Fisher Scientific channel, Europe. "By adding Bio-Techne's high-quality products to our comprehensive portfolio, we aim to further empower scientists and researchers with the tools they need to drive breakthrough discoveries and advancements in healthcare."
Bio-Techne's state-of-the-art products are designed to accelerate research and improve outcomes in areas including cell and gene therapy, immunology, neuroscience, and more. With this collaboration, Thermo Fisher reinforces its commitment to providing customers with access to the latest technologies and expertise, ultimately advancing scientific knowledge and improving human health.
«Estamos muy contentos de asociarnos con Thermo Fisher para ampliar el alcance de nuestros productos y servicios en toda Europa», dijo Kim Kelderman, Presidente y Director Ejecutivo de Bio-Techne. «Al aprovechar la amplia red de distribución europea y la experiencia en el sector del canal Fisher Scientific, pretendemos mejorar el apoyo a los investigadores y acelerar los descubrimientos científicos que abordan algunos de los retos más acuciantes de la atención sanitaria actual.»
Este acuerdo de distribución subraya la dedicación de Thermo Fisher a fomentar la innovación y la colaboración dentro de la comunidad científica. A través de asociaciones estratégicas con empresas líderes como Bio-Techne, Thermo Fisher continúa reforzando su posición como socio de confianza para investigadores y laboratorios de toda Europa.
Acerca de Bio-Techne
Bio-Techne Corporation (NASDAQ: TECH) es una empresa global de ciencias de la vida que proporciona herramientas innovadoras y reactivos bioactivos para las comunidades de investigación y diagnóstico clínico. Los productos de Bio-Techne contribuyen a la investigación científica de los procesos biológicos y de la naturaleza y evolución de determinadas enfermedades. Ayudan a descubrir fármacos y proporcionan los medios para realizar pruebas y diagnósticos clínicos precisos. Con miles de productos en su cartera, Bio-Techne generó más de 1.100 millones de dólares en ventas netas en el año fiscal 2023 y cuenta con aproximadamente 3.100 empleados en todo el mundo.
¿Preguntas? Póngase en contacto con un especialista >
ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.
Sinónimo | Double-stranded RNA |
---|---|
Requisitos de almacenamiento | Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles. |
Especificidad | The dsRNA Detection Kit allows sensitive and selective detection of dsRNA molecules (larger than 30-40 bp), independent of their nucleotide composition and sequence. |
Tipo de producto | ELISA Kit (Colorimetric) |
Sensibilidad del ensayo | 3 ng/ml |
Objetivo | Multi-Species |
Intervalo del ensayo | 1 - 300 ng/ml (0.1 - 30 ng/well) |
Para utilizar con (aplicación) | ELISA |
Rabbit Polyclonal Antibody has been used in 4 publications
Método de purificación | Affinity Purified |
---|---|
Inmunógeno | A synthetic peptide made to a C-terminal portion of human Factor VIII (between amino acids 2100-2250) [UniProt P00451] |
Símbolos de los genes | F8 |
Especies diana | Mouse,Rat |
Estado normativo | RUO |
Especie del huésped | Rabbit |
Antígeno | Factor VIII |
Aplicaciones | Western Blot,Immunofluorescence,Immunohistochemistry (Paraffin) |
Requisitos de almacenamiento | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
---|---|
Formulación | Lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4. |
Concentración | LYOPH |
Expresión | HMGB1/HMG-1 |
Símbolo de gen | HMGB1 |
ID de gen (Entrez) | 3146 |
Concentración de endotoxinas | Less than 1 EU/ug of HMGB1/HMG-1 as determined by LAL method. |
Número de acceso | P09429, P09429, P09429 |
Grado de pureza o calidad | >95% by SDS-PAGE and HPLC |
Peso molecular | 26 kDa |
Reconstitución | Recommended to centrifuge prior to opening. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0mg/mL. Apportion stock solutions into working aliquots and store at <-20°C. |
Alias de gen | Amphoterin, high mobility group box 1, High mobility group protein 1, high mobility group protein B1, high-mobility group (nonhistone chromosomal) protein 1, high-mobility group box 1, HMG-1, HMG1DKFZp686A04236, HMG3, SBP-1, Sulfoglucuronyl carbohydrate binding protein |
Categoría de investigación | Cellular Markers, Chromatin Research, Neuroscience |
Para utilizar con (aplicación) | PAGE |
Mouse Monoclonal Antibody has been used in 1 publication
Primario o secundario | Primary |
---|---|
Método de purificación | Protein G purified |
Concentración | 1 mg/mL |
Inmunógeno | Fusion protein amino acids 597-802 (C-terminus) of rat Npas4. |
Dilución | Western Blot 1:1000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:100, Immunohistochemistry-Frozen |
Formulario | Purified |
Clon | S408-79 |
Isotype | IgG1 |
Símbolos de los genes | NPAS4 |
Especie del huésped | Mouse |
Conjugado | Unconjugated |
ID de gen (Entrez) | 266743 |
Antígeno | Npas4 |
Alias de gen | BHLHE79, bHLHe79neuronal PAS domain-containing protein 4, Class E basic helix-loop-helix protein 79, Le-PAS, neuronal PAS domain protein 4, Neuronal PAS4, NXFHLH-PAS transcription factor NXF, PASD10PAS domain-containing protein 10 |
Especificidad de la prueba | Detects 90kDa. |
Especies diana | Human,Mouse,Rat |
Estado normativo | RUO |
Clasificación | Monoclonal |
Mouse Monoclonal Antibody
Rabbit Polyclonal Antibody has been used in 1 publication
Primario o secundario | Primary |
---|---|
Formulación | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Método de purificación | Affinity Purified |
Inmunógeno | This antibody was developed against Recombinant Protein corresponding to amino acids:PDVLENKCGYTLCIYGRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILIEMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSKIPRKASSLTPL |
Dilución | Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:200-1:500 |
Isotype | IgG |
Símbolos de los genes | IL1RL1 |
Especie del huésped | Rabbit |
Conjugado | Unconjugated |
ID de gen (Entrez) | 9173 |
Antígeno | ST2/IL-33R |
Disciplina de investigación | Angiogenesis |
Aplicaciones | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
Contenido y almacenamiento | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Alias de gen | DER4ST2growth stimulation-expressed, FIT-1, IL33R, interleukin 1 receptor-like 1, interleukin 1 receptor-related protein, interleukin-1 receptor-like 1, MGC32623, Protein ST2, ST2L, ST2V, T1homolog of mouse growth stimulation-expressed |
Especificidad de la prueba | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Especies diana | Human |
Estado normativo | RUO |
Clasificación | Polyclonal |
Rabbit Polyclonal Antibody has been used in 16 publications
Mouse Monoclonal Antibody has been used in 35 publications
Primario o secundario | Primary |
---|---|
Método de purificación | Protein G purified |
Concentración | 1 mg/mL |
Peso molecular del antígeno | 140 kDa |
Inmunógeno | This N-Cadherin Antibody (13A9) was developed against the cytoplasmic domain of human N Cadherin [Swiss-Prot# P19022]. |
Dilución | Western Blot 0.5 ug/ml, Simple Western 1:50, Flow Cytometry, Immunohistochemistry 1:50-1:200, Immunocytochemistry/Immunofluorescence 1:100, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:50-1:100, Flow (Intracellular), Immunocytochemistry |
Formulario | Purified |
Clon | 13A9 |
Isotype | IgG1 |
Símbolos de los genes | CDH2 |
Especie del huésped | Mouse |
Conjugado | Unconjugated |
ID de gen (Entrez) | 1000 |
Antígeno | N-Cadherin |
N.º de referencia del gen | P19022 |
Disciplina de investigación | Cancer, Cell Cycle and Replication, Cellular Markers, Extracellular Matrix, Mesenchymal Stem Cell Markers, Neuroscience, Plasma Membrane Markers, Signal Transduction, Stem Cells |
Aplicaciones | Western Blot,Flow Cytometry,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunoprecipitation,Immunohistochemistry (Paraffin) |
Contenido y almacenamiento | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Alias de gen | cadherin 2, N-cadherin (neuronal), cadherin 2, type 1, N-cadherin (neuronal), cadherin-2, CD325, CD325 antigen, CDHNcalcium-dependent adhesion protein, neuronal, CDw325, N-cadherin, NCADN-cadherin 1, Neural cadherin, neural-cadherin |
Especies diana | Human,Mouse,Rat |
Estado normativo | RUO |
Clasificación | Monoclonal |
Rat Monoclonal Antibody has been used in 19 publications
Primario o secundario | Primary |
---|---|
Método de purificación | Tissue culture supernatant |
Inmunógeno | Bovine MBP |
Dilución | Western Blot 1:100-1:2000, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Immunohistochemistry-Frozen 1:10-1:500, Radioimmunodiffusion |
Formulario | Supernatant |
Clon | 12 |
Isotype | IgG2a |
Símbolos de los genes | MBP |
Especie del huésped | Rat |
Conjugado | Unconjugated |
ID de gen (Entrez) | 4155 |
Antígeno | MBP |
N.º de referencia del gen | P02687 |
Disciplina de investigación | Neuroscience, Neurotransmission, Oligodendrocyte Cell Markers, Stem Cell Markers |
Aplicaciones | Western Blot |
Contenido y almacenamiento | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Alias de gen | MGC99675, Myelin A1 protein, myelin basic protein, Myelin membrane encephalitogenic protein |
Especificidad de la prueba | NB600-717 reacts with myelin basic protein from a wide range of species. The antibody reacts weakly with peptides ending in the Phe 91 where the 91-92 Phe-Phe bond is broken. Synthetic peptide 82-99 reacts very well, as does intact MBP. Further epitope analysis indicates binding to a region defined by amino acids 82-87 (DENPVV). Clone 12 has been reported as being suitable for use in Western blotting. |
Especies diana | Human |
Estado normativo | RUO |
Clasificación | Monoclonal |
Primario o secundario | Primary |
---|---|
Formulación | PBS (pH 7.3), 50% glycerol |
Método de purificación | Affinity purified |
Inmunógeno | A synthetic peptide corresponding to a sequence within amino acids 420-658 of human CPT2 (NP_000089.1).,, Sequence:, VALDKQNKHTSYISGPWFDMYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHLNPAKSDTITFKRLIRFVPSSLS |
Dilución | Western Blot 1:100 - 1:500, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Formulario | Purified |
Isotype | IgG |
Especie del huésped | Rabbit |
Conjugado | Unconjugated |
ID de gen (Entrez) | 1376 |
Antígeno | CPT2 |
Disciplina de investigación | Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction |
Aplicaciones | ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin) |
Contenido y almacenamiento | Store at -20°C. Avoid freeze-thaw cycles. |
Alias de gen | carnitine O-palmitoyltransferase 2, mitochondrial, carnitine palmitoyltransferase 2, Carnitine palmitoyltransferase IIEC 2.3.1.21, CPT II, CPT1, CPTASE |
Especies diana | Human,Mouse,Rat |
Estado normativo | RUO |
Clasificación | Polyclonal |
Primario o secundario | Primary |
---|---|
Formulación | PBS (pH 7.3), 50% glycerol |
Método de purificación | Affinity purified |
Inmunógeno | Recombinant fusion protein containing a sequence corresponding to amino acids 8-245 of human ETHE1 (NP_055112.2).,, Sequence:, VARRQLSQRGGSGAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANM |
Dilución | Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Formulario | Purified |
Isotype | IgG |
Especie del huésped | Rabbit |
Conjugado | Unconjugated |
ID de gen (Entrez) | 23474 |
Antígeno | ETHE1 |
Disciplina de investigación | metabolism |
Aplicaciones | ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence |
Contenido y almacenamiento | Store at -20°C. Avoid freeze-thaw cycles. |
Alias de gen | D83198, EC 3.1.2.6, ethylmalonic encephalopathy 1, Ethylmalonic encephalopathy protein 1, Hepatoma subtracted clone one protein, HSCOEC 3.-, protein ETHE1, mitochondrial, YF13H12 |
Especies diana | Human,Mouse,Rat |
Estado normativo | RUO |
Clasificación | Polyclonal |
Primario o secundario | Primary |
---|---|
Formulación | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Método de purificación | Affinity Purified |
Inmunógeno | This antibody was developed against a recombinant protein corresponding to amino acids: VFGAIISYFEQFFETVGISLANQQYVSGDGSEATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINIKDRSSTTSTWELLDQR |
Dilución | Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
Isotype | IgG |
Símbolos de los genes | CARS2 |
Especie del huésped | Rabbit |
Conjugado | Unconjugated |
ID de gen (Entrez) | 79587 |
Antígeno | CARS2 |
Aplicaciones | Western Blot,Immunocytochemistry,Immunofluorescence,Immunofluorescence,Immunohistochemistry (Paraffin) |
Contenido y almacenamiento | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Alias de gen | CysRS, Cysteine TRNA Ligase 2, Cysteine TRNA Ligase 2, Mitochondrial (Putative), Cysteine--tRNA ligase, cysteinyl-tRNA synthetase, Cysteinyl-TRNA Synthetase 2, Mitochondrial (Putative), EC 6.1.1, EC 6.1.1.16, Mitochondrial (Putative), Probable Cysteine--TRNA Ligase, Mitochondrial, Probable Cysteinyl-TRNA Synthetase, Mitochondrial |
Especificidad de la prueba | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Especies diana | Human |
Estado normativo | RUO |
Clasificación | Polyclonal |