missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ UBLCP1 Recombinant Protein
Marca: Abnova™ H00134510-P01.25ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Especificaciones
| NP_659486 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 61 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 μg | |
| MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREESLGDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPREGKKLLVLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVHTPRRGLIDVKPLGVIWGKFSEFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDKDKELLKLTQYLKEIAKLDDFLDLNHKYWERYLSKKQGQ | |
| CPUB1/FLJ25267/MGC10067 | |
| UBLCP1 | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 134510 | |
| UBLCP1 (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| UBLCP1 | |
| Human | |
| Recombinant | |
| Solution |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Abnova™ UBLCP1 Recombinant Protein > 25μg
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido