Abnova™ UBLCP1 Recombinant Protein

344.00€ - 521.00€

Especificaciones

Número de acceso	NP_659486
Para utilizar con (aplicación)	Antibody Production, Protein Array, ELISA, Western Blot
Formulación	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
ID de gen (Entrez)	134510
Peso molecular	61

Ver más especificaciones

Productos 2

Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
16158043 Ver documentos missing translation for 'viewProductCertificates'	Abnova™ H00134510-P01.10ug	10 μg	344.00€ 10 microgramos		Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

16168043 Ver documentos missing translation for 'viewProductCertificates'	Abnova™ H00134510-P01.25ug	25 μg	521.00€ 25 microgramos		Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Descripción

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Número de acceso	NP_659486
Formulación	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Peso molecular	61
Intervalo de pH	8
Método de purificación	Glutathione Sepharose 4 Fast Flow
Fuente	Wheat Germ (in vitro)
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Nombre común	UBLCP1
Reactividad cruzada	Human
Recombinante	Recombinant
Formulario	Solution

Para utilizar con (aplicación)	Antibody Production, Protein Array, ELISA, Western Blot
ID de gen (Entrez)	134510
Nombre	UBLCP1 (Human) Recombinant Protein (P01)
Método de preparación	In vitro wheat germ expression system
Pruebas de control de calidad	12.5% SDS-PAGE Stained with Coomassie Blue.
Inmunógeno	MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREESLGDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPREGKKLLVLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVHTPRRGLIDVKPLGVIWGKFSEFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDKDKELLKLTQYLKEIAKLDDFLDLNHKYWERYLSKKQGQ
Alias de gen	CPUB1/FLJ25267/MGC10067
Símbolo de gen	UBLCP1
Especie	Wheat Germ (in vitro)
Etiqueta de proteína	GST

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Abnova™ UBLCP1 Recombinant Protein

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Abnova™ UBLCP1 Recombinant Protein

Especificaciones

Descripción

Especificaciones

Documentos