Learn More
Abnova™ S100A8 Recombinant Protein
Human S100A8 full-length ORF recombinant protein with GST-tag at N-terminal
344.00€ - 521.00€
Especificaciones
Número de acceso | AAH05928.1 |
---|---|
Para utilizar con (aplicación) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulación | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
ID de gen (Entrez) | 6279 |
Peso molecular | 35.97 |
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
---|---|---|---|---|---|---|---|---|---|
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
16160462
|
Abnova™
H00006279-P01.10ug |
10 μg |
344.00€
10 microgramos |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
16170462
|
Abnova™
H00006279-P01.25ug |
25 μg |
521.00€
25 microgramos |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis.
- Theoretical MW (kDa): 35.97
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Best when used within three months from the date of receipt.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Especificaciones
AAH05928.1 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
35.97 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
S100A8 | |
Human | |
Recombinant | |
Solution |
Antibody Production, Protein Array, ELISA, Western Blot | |
6279 | |
S100A8 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE | |
60B8AG/CAGA/CFAG/CGLA/CP-10/L1Ag/MA387/MIF/MRP8/NIF/P8 | |
S100A8 | |
Wheat Germ (in vitro) | |
GST |
Seguridad y manipulación
- S100A8 (Human) Recombinant Protein (P01)
Palabra de advertencia
- Atención
Clasificación
- Toxicidad aguda Categoría 4
- Lesión ocular grave/irritación ocular Categoría 2
- Corrosión o irritación cutáneas Categoría 2
Indicaciones de peligro
- H302-Nocivo en caso de ingestión.
- H315-Provoca irritación cutánea.
- H319-Provoca irritación ocular grave.
Consejos de prudencia
- P102-Mantener fuera del alcance de los niños.
- P103-Leer la etiqueta antes del uso.
- P233-Mantener el recipiente herméticamente cerrado.
- P264-Lavarse concienzudamente tras la manipulación.
- P270-No comer, beber ni fumar durante su utilización.
- P280-Llevar guantes/prendas/gafas/máscara de protección.
- P301+P310-EN CASO DE INGESTIÓN: Llamar inmediatamente a un CENTRO DE TOXICOLOG A/médico/.
- P305+P351+P338-EN CASO DE CONTACTO CON LOS OJOS: Aclarar cuidadosamente con agua durante varios minutos. Quitar las lentes de contacto, si lleva y resulta fácil. Seguir aclarando.
- P404-Almacenar en un recipiente cerrado.
- P501b-Eliminar el contenido/el recipiente en conforme a la reglamentación local/regional/nacional/internacional.
Otros peligros
- MIXTURE LIST-Contém: tris-HCl, reduced glutathione
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.