missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ S100A8 Recombinant Protein

Código de producto. 16160462
Change view
Click to view available options
Cantidad:
10 μg
25 μg
Tamaño de la unidad:
10 microgramos
25 microgramos
Código de producto. Cantidad unitSize
16160462 10 μg 10 microgramos
16170462 25 μg 25 microgramos
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16160462

Marca: Abnova™ H00006279P01.10ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Human S100A8 full-length ORF recombinant protein with GST-tag at N-terminal

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis.

  • Theoretical MW (kDa): 35.97
  • Preparation method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 fast flow
  • Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Best when used within three months from the date of receipt.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Número de acceso AAH05928.1
Para utilizar con (aplicación) Antibody Production, Protein Array, ELISA, Western Blot
Formulación 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
ID de gen (Entrez) 6279
Peso molecular 35.97
Nombre S100A8 (Human) Recombinant Protein (P01)
Intervalo de pH 8
Método de preparación In vitro wheat germ expression system
Método de purificación Glutathione Sepharose 4 Fast Flow
Pruebas de control de calidad 12.5% SDS-PAGE Stained with Coomassie Blue.
Cantidad 10 μg
Fuente Wheat Germ (in vitro)
Inmunógeno MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gen 60B8AG/CAGA/CFAG/CGLA/CP-10/L1Ag/MA387/MIF/MRP8/NIF/P8
Nombre común S100A8
Símbolo de gen S100A8
Reactividad cruzada Human
Especie Wheat Germ (in vitro)
Recombinante Recombinant
Etiqueta de proteína GST
Formulario Solution
Mostrar más Mostrar menos
compliance-icons
Nombre del producto
  • S100A8 (Human) Recombinant Protein (P01)
Palabra de advertencia
  • Atención
Clasificación
  • Toxicidad aguda Categoría 4
  • Lesión ocular grave/irritación ocular Categoría 2
  • Corrosión o irritación cutáneas Categoría 2
Indicaciones de peligro
  • H302-Nocivo en caso de ingestión.
  • H315-Provoca irritación cutánea.
  • H319-Provoca irritación ocular grave.
Consejos de prudencia
  • P102-Mantener fuera del alcance de los niños.
  • P103-Leer la etiqueta antes del uso.
  • P233-Mantener el recipiente herméticamente cerrado.
  • P264-Lavarse concienzudamente tras la manipulación.
  • P270-No comer, beber ni fumar durante su utilización.
  • P280-Llevar guantes/prendas/gafas/máscara de protección.
  • P301+P310-EN CASO DE INGESTIÓN: Llamar inmediatamente a un CENTRO DE TOXICOLOG A/médico/.
  • P305+P351+P338-EN CASO DE CONTACTO CON LOS OJOS: Aclarar cuidadosamente con agua durante varios minutos. Quitar las lentes de contacto, si lleva y resulta fácil. Seguir aclarando.
  • P404-Almacenar en un recipiente cerrado.
  • P501b-Eliminar el contenido/el recipiente en conforme a la reglamentación local/regional/nacional/internacional.
Otros peligros
  • MIXTURE LIST-Contém: tris-HCl, reduced glutathione
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.