missing translation for 'onlineSavingsMsg'
Learn More
Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active) Código de producto.: 18735843
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Código de producto. p-7120949 Tienda Bio Techne Productos
100 μg, 1 set
Click to view available options
Cantidad:
100 μg
200 μg
500 μg
Tamaño de la unidad:
1 set
200 microgramos
500 microgramos
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18735843

Marca: Novus Biologicals™ NBP254789100UG

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Highly purified and high bioactivity. Generating reliable and reproducible results.

An un-tagged full length Human biologically active Alpha-Synuclein recombinant protein aggregate (pre-formed fibrils, Type 1), NCBI Accession #: NP_000336.1. The Recombinant Human alpha-Synuclein Aggregate Protein is derived from E. coli. The Recombinant Human alpha-Synuclein Aggregate Protein has been validated for the following applications: Western Blot, In vitro assay, In vivo assay, SDS-Page, Bioactivity.
TRUSTED_SUSTAINABILITY

Especificaciones

Para utilizar con (aplicación) In vitro Assay, In vivo Assay, SDS-PAGE, Western Blot
Formulación PBS
ID de gen (Entrez) 6622
Nombre Human alpha-Synuclein Aggregate Protein
Método de purificación >95% pure by SDS-PAGE
Cantidad 100 μg
Fuente E.Coli
Inmunógeno MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Requisitos de almacenamiento Store at −80°C. Avoid freeze-thaw cycles.
Estado normativo RUO
Alias de gen alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor)
Símbolo de gen SNCA
Actividad biológica Endogenous alpha-synuclein phosphorylation. 100μM alpha synuclein protein monomer seeded with 10nM alpha synuclein protein aggregate in 25μM Thioflavin T (PBS pH 7.4, 100μL reaction volume) generated a fluorescence intensity of 13,000 Relative Fluorescence Units after incubation at 37°C with shaking at 600 rpm for 24 hours. Fluorescence was measured by excitation at 450nm and emission at 485nm on a Molecular Devices Gemini XPS microplate reader.
Tipo de producto Recombinant Protein
Conjugado Unconjugated
Reactividad cruzada Human
Recombinante Recombinant
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active) >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado