missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PCSK4 (Human) Recombinant Protein

Human PCSK4 full-length ORF ( AAH36354, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00054760-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16170733

  • 508.00€ / 25 microgramos
Fecha estimada de envío: 25-06-2024
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

  • Sequence: MGTRSTLVAIRPLDVSTEGYNNWVFMSTHFWDENPQGVWTLGLENKGYYFNTGTLYRYTLLLYGTAEDMTARPTGPQVTSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRGGSPRDCTSCPPSSTLDQQQGSCMGPTTPDSRPRLRAAACPHHRCPASAMVLSLLAVTLGGPVLCGMSMDLPLYAWLSRARATPTKPQVWLPAGT
Especificaciones

Especificaciones

AAH36354
proprotein convertase subtilisin/kexin type 4
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PCSK4
GST
54760
Wheat germ expression system
25 μg
DKFZp434B217, MGC34749, PC4, SPC5
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales