missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PCSK4 (Human) Recombinant Protein

Human PCSK4 full-length ORF ( AAH36354, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal.

335.00€ - 508.00€

Especificaciones

Número de acceso AAH36354
ID de gen (Entrez) 54760
Nombre proprotein convertase subtilisin/kexin type 4
Método de preparación Wheat germ expression system
Pruebas de control de calidad 125% SDS-PAGE Stained with Coomassie Blue
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16160733
Ver documentos Detalles de la promoción
Abnova™
H00054760-P01.10UG
10 μg
335.00€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 17-07-2024
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16170733
Ver documentos Detalles de la promoción
Abnova™
H00054760-P01.25UG
25 μg
508.00€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 17-07-2024
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

  • Sequence: MGTRSTLVAIRPLDVSTEGYNNWVFMSTHFWDENPQGVWTLGLENKGYYFNTGTLYRYTLLLYGTAEDMTARPTGPQVTSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRGGSPRDCTSCPPSSTLDQQQGSCMGPTTPDSRPRLRAAACPHHRCPASAMVLSLLAVTLGGPVLCGMSMDLPLYAWLSRARATPTKPQVWLPAGT
Especificaciones

Especificaciones

AAH36354
proprotein convertase subtilisin/kexin type 4
125% SDS-PAGE Stained with Coomassie Blue
DKFZp434B217, MGC34749, PC4, SPC5
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
54760
Wheat germ expression system
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PCSK4
GST
Videos
SDS
Documentos

Documentos

Product Certifications