missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ MAP2K5 Recombinant Protein
Recombinant protein for MAP2K5 (human) gene
344.00€ - 521.00€
Especificaciones
| Para utilizar con (aplicación) | Antibody Production, Protein Array, ELISA, Western Blot |
|---|---|
| Formulación | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Peso molecular | 75.02 |
| Intervalo de pH | 8 |
| Método de preparación | In vitro wheat germ expression system |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
16159651
|
Abnova™
H00005607-P01.10ug |
10 μg |
344.00€
10 microgramos |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
16169651
|
Abnova™
H00005607-P01.25ug |
25 μg |
521.00€
25 microgramos |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
The encoded protein is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically interacts with and activates MAPK7/ERK5. This kinase itself can be phosphorylated and activated by MAP3K3/MEKK3, as well as by atypical protein kinase C isoforms (aPKCs).
- Human MAP2K5 full-length ORF ( AAH08838, 1 a.a. - 448 a.a.) recombinant protein with GST-tag at N-terminal
- Description: mitogen-activated protein kinase 5
- Theoretical molecular weight: 75.02kDa
- Preparation: in vitro wheat germ expression system
- Purification: glutathione sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced glutathione, pH: 8.0 in elution buffer
Sequence: MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGLKVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTVYKAYH VPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISICTEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQKNQGSLMPLQLLQCIVDEDSPVLPVGESSEPFVHFITQCMRKQPKERPAPEELMGHPFIVQFNDGNAAVVSMWVCRALEERRSQQGPP
Best use within three months from the date of receipt.
ELISA, western blotting (recombinant protein), antibody production, protein array
Especificaciones
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 75.02 | |
| In vitro wheat germ expression system | |
| Wheat Germ (in vitro) | |
| Recombinant |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| Human | |
| Solution |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Abnova™ MAP2K5 Recombinant Protein