Learn More
Abnova™ MAP2K5 Recombinant Protein
Descripción
The encoded protein is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically interacts with and activates MAPK7/ERK5. This kinase itself can be phosphorylated and activated by MAP3K3/MEKK3, as well as by atypical protein kinase C isoforms (aPKCs).
- Human MAP2K5 full-length ORF ( AAH08838, 1 a.a. - 448 a.a.) recombinant protein with GST-tag at N-terminal
- Description: mitogen-activated protein kinase 5
- Theoretical molecular weight: 75.02kDa
- Preparation: in vitro wheat germ expression system
- Purification: glutathione sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced glutathione, pH: 8.0 in elution buffer
Sequence: MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGLKVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTVYKAYH VPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISICTEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQKNQGSLMPLQLLQCIVDEDSPVLPVGESSEPFVHFITQCMRKQPKERPAPEELMGHPFIVQFNDGNAAVVSMWVCRALEERRSQQGPP
Best use within three months from the date of receipt.
ELISA, western blotting (recombinant protein), antibody production, protein array
Especificaciones
Especificaciones
| Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulación | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Peso molecular | 75.02 |
| Nombre | Human MAP2K5 Full-length ORF Recombinant Protein with GST-tag at N-terminal |
| Intervalo de pH | 8 |
| Método de preparación | In vitro wheat germ expression system |
| Método de purificación | Glutathione Sepharose 4 Fast Flow |
| Pruebas de control de calidad | 12.5% SDS-PAGE stained with Coomassie Blue |
| Cantidad | 25 μg |
| Fuente | Wheat Germ (in vitro) |
| Mostrar más |
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.