missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ MAP2K5 Recombinant Protein

Recombinant protein for MAP2K5 (human) gene

Marca:  Abnova™ H00005607-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16169651

  • 508.00€ / 25 microgramos
Fecha estimada de envío: 04-07-2024
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

The encoded protein is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically interacts with and activates MAPK7/ERK5. This kinase itself can be phosphorylated and activated by MAP3K3/MEKK3, as well as by atypical protein kinase C isoforms (aPKCs).

  • Human MAP2K5 full-length ORF ( AAH08838, 1 a.a. - 448 a.a.) recombinant protein with GST-tag at N-terminal
  • Description: mitogen-activated protein kinase 5
  • Theoretical molecular weight: 75.02kDa
  • Preparation: in vitro wheat germ expression system
  • Purification: glutathione sepharose 4 fast flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced glutathione, pH: 8.0 in elution buffer

Sequence: MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGLKVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTVYKAYH VPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISICTEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQKNQGSLMPLQLLQCIVDEDSPVLPVGESSEPFVHFITQCMRKQPKERPAPEELMGHPFIVQFNDGNAAVVSMWVCRALEERRSQQGPP

Best use within three months from the date of receipt.

ELISA, western blotting (recombinant protein), antibody production, protein array

Especificaciones

Especificaciones

Antibody Production, ELISA, Protein Array, Western Blot
75.02
8
Glutathione Sepharose 4 Fast Flow
25μg
-80°C
Recombinant
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Human MAP2K5 Full-length ORF Recombinant Protein with GST-tag at N-terminal
In vitro wheat germ expression system
12.5% SDS-PAGE stained with Coomassie Blue
Wheat Germ (in vitro)
Human
Solution
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers