missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PDEF (aa 92-158) Control Fragment Recombinant Protein

Recombinant Protein

Marca:  Invitrogen™ RP106659

Código de producto. 30194227

  • 265.00€ / 100 microlitros

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Explore más ofertas especiales
Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Descripción

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PDEF (prostate-derived Ets factor) is a 37.5-kDa protein that acts as an androgen-independent transcriptional activator for the PSA (prostate specific antigen) promoter. It also interacts directly with the DNA binding domain of androgen receptor and enhances androgen-mediated activation of the PSA promoter. PDEF was shown to have transcript levels 192-fold higher in the peripheral blood of some breast cancer patients in comparison with normal individuals. PDEF mRNA is also frequently over-expressed in human breast tumors as well as in human ovarian tumors. In ovarian tumors, PDEF expression seems to down-modulate malignant potential, and thus provides a rationale to screen for drugs that induce PDEF expression in epithelial ovarian tumors.
TRUSTED_SUSTAINABILITY
Especificaciones

Especificaciones

O95238
Blocking Assay, Control
25803
100 μL
bA375E1.3; PDEF; Prostate epithelium-specific Ets transcription factor; prostate specific ets transcription factor; prostate-derived Ets factor; Prostate-specific Ets; Pse; SAM pointed domain containing ets transcription factor; SAM pointed domain-containing Ets transcription factor; SPDEF
Spdef
Human
His-ABP-tag
-20°C, Avoid Freeze/Thaw Cycles
Liquid
≥5.0 mg/mL
1 M urea, PBS with no preservative; pH 7.4
Human PDEF (aa 92-158) Control Fragment
RUO
PDEF
Unconjugated
Recombinant
QCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKW
E. coli
>80% by SDS-PAGE and Coomassie blue staining
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados

Certificados

Se requiere un número de lote para mostrar resultados para certificados. Para encontrar su número de lote en pedidos anteriores, utilice el área de estado de pedidos.

1 Resultados encontrados
Número de lote Tipo de certificado Fecha Catalog Number
Número de lotePRL03891 Tipo de certificadoCertificado de análisis Fecha07/04/2025 Catalog Number
Ofertas especiales

Ofertas especiales

Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human PDEF (aa 92-158) Control Fragment Recombinant Protein > 100 μL; Unlabeled

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado