Learn More
Invitrogen™ Human PDEF (aa 92-158) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP106659
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
PDEF (prostate-derived Ets factor) is a 37.5-kDa protein that acts as an androgen-independent transcriptional activator for the PSA (prostate specific antigen) promoter. It also interacts directly with the DNA binding domain of androgen receptor and enhances androgen-mediated activation of the PSA promoter. PDEF was shown to have transcript levels 192-fold higher in the peripheral blood of some breast cancer patients in comparison with normal individuals. PDEF mRNA is also frequently over-expressed in human breast tumors as well as in human ovarian tumors. In ovarian tumors, PDEF expression seems to down-modulate malignant potential, and thus provides a rationale to screen for drugs that induce PDEF expression in epithelial ovarian tumors.
Especificaciones
O95238 | |
Blocking Assay, Control | |
25803 | |
100 μL | |
bA375E1.3; PDEF; Prostate epithelium-specific Ets transcription factor; prostate specific ets transcription factor; prostate-derived Ets factor; Prostate-specific Ets; Pse; SAM pointed domain containing ets transcription factor; SAM pointed domain-containing Ets transcription factor; SPDEF | |
Spdef | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human PDEF (aa 92-158) Control Fragment | |
RUO | |
PDEF | |
Unconjugated | |
Recombinant | |
QCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKW | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Certificados
Se requiere un número de lote para mostrar resultados para certificados. Para encontrar su número de lote en pedidos anteriores, utilice el área de estado de pedidos.
Número de lote | Tipo de certificado | Fecha | Catalog Number |
---|---|---|---|
PRL03891 | Certificado de análisis | 07/04/2025 |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.