Learn More
Invitrogen™ Human IkB alpha (aa 1-144) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP88900
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
IkB-alpha is a 40 kDa protein that functions to inhibit NF- kappaB activity. The inhibition occurs via protein-protein interaction between I kappaB proteins and NF- kappaB dimers in the cytosol. The interaction of I kappa B-alpha with NF- kappaB masks the nuclear localization sequence of NF- kappaB, preventing NF- kappaB translocation to the nucleus. A variety of stimuli can activate gene expression by liberating NF- kappaB through the degradation of I kappaB alpha. These stimuli include the proinflammatory cytokines TNF- alpha and IL-1 beta, chemokines, PMA, growth factors, LPS, UV irradiation, viral infection, as well as various chemical and physical stresses. In humans, the gene is located on the q arm of chromosome 14. Activation of NFkB requires that IkB be phosphorylated on specific serine residues, which results in targeted degradation of IkB. IkB kinase alpha (IKK alpha), previously designated CHUK, interacts with IkB-alpha and specifically phosphorylates IkB-alpha on the sites that trigger its degradation Serines 32 and 36. IKK alpha appears to be critical for NFkB activation in response to proinflammatory cytokines. Phosphorylation of IkB by IKK alpha is stimulated by the NFkB inducing kinase (NIK), which itself is a central regulator for NFkB activation in response to TNF and IL-1. The functional IKK complex contains three subunits, IKK alpha, IKK beta and IKK gamma, and each appear to make essential contributions to IkB phosphorylation.
Especificaciones
P25963 | |
Blocking Assay, Control | |
4792 | |
100 μL | |
AI462015; ECI-6; ECI-6/IKBA; I kappa B-alpha; I(Kappa)B(alpha); I79_018146; IkappaB alpha; IkappaBalpha; I-kappaBalpha; I-kappa-B-alpha; Ikba; IKBalpha; IKB-alpha; Inhibitor of nuclear factor of kappa light chain gene enhancer in B-cells alpha; Inhibitor of nuclear factor of kappa light chain gene enhancer in B-cells, alpha; MAD3; MAD-3; Major histocompatibility complex enhancer-binding protein MAD3; NF kappa B inhibitor alpha; NF-kappaB inhibitor alpha; NF-kappa-B inhibitor alpha; NFKB inhibitor alpha; NFKBI; Nfkbia; nuclear factor of kappa light chain gene enhancer in B-cells; nuclear factor of kappa light chain gene enhancer in B-cells inhibitor, alpha; nuclear factor of kappa light polyp gene enhancer in B-cell 1; nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, alpha; nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha; Rel-associated pp40; REL-associated protein pp40; RL/IF-1 | |
NFKBIA | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human IkB alpha (aa 1-144) Control Fragment | |
RUO | |
IkB alpha | |
Unconjugated | |
Recombinant | |
MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRG | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.