missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ GNRHR2 (Human) Recombinant Protein
Human GNRHR2 partial ORF ( NP_001457, 237 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal.
344.00€ - 521.00€
Especificaciones
Número de acceso | NP_001457 |
---|---|
ID de gen (Entrez) | 114814 |
Nombre | gonadotropin-releasing hormone (type 2) receptor 2 |
Método de preparación | Wheat germ expression system |
Pruebas de control de calidad | 125% SDS-PAGE Stained with Coomassie Blue |
Descripción
- Sequence: TLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI
Especificaciones
NP_001457 | |
gonadotropin-releasing hormone (type 2) receptor 2 | |
125% SDS-PAGE Stained with Coomassie Blue | |
GnRH-II-R | |
Wheat Germ (in vitro) | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
114814 | |
Wheat germ expression system | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
GNRHR2 | |
GST |
Seguridad y manipulación
missing translation for 'shelfLife' : Best use within three months from the date of receipt of this protein
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Abnova™ GNRHR2 (Human) Recombinant Protein