missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ GNRHR2 (Human) Recombinant Protein
Click to view available options
Cantidad:
10 μg
25 μg
Tamaño de la unidad:
10 microgramos
25 microgramos
Descripción
- Sequence: TLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI
Especificaciones
Especificaciones
| Número de acceso | NP_001457 |
| ID de gen (Entrez) | 114814 |
| Nombre | gonadotropin-releasing hormone (type 2) receptor 2 |
| Método de preparación | Wheat germ expression system |
| Pruebas de control de calidad | 125% SDS-PAGE Stained with Coomassie Blue |
| Cantidad | 25 μg |
| Requisitos de almacenamiento | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Alias de gen | GnRH-II-R |
| Símbolo de gen | GNRHR2 |
| Especie | Wheat Germ (in vitro) |
| Mehr anzeigen |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur