missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ FGF21 Recombinant Protein
Human FGF21 full-length ORF recombinant protein with GST-tag at N-terminal
Marca: Abnova™ H00026291-P01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined.
- Theoretical MW (kDa): 45.54
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Best use within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Especificaciones
| AAH18404 | |
| Solution | |
| 26291 | |
| FGF21 (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FGF21 | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 45.54 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS | |
| FGF21 | |
| Human | |
| Yes |