missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FGF21 Recombinant Protein

Código de producto. p-3718862
Change view
Click to view available options
Cantidad:
10 μg
25 μg
Tamaño de la unidad:
10 microgramos
25 microgramos
Código de producto. Cantidad unitSize
16158292 10 μg 10 microgramos
16168292 25 μg 25 microgramos
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16158292

Marca: Abnova™ H00026291P01.10ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Human FGF21 full-length ORF recombinant protein with GST-tag at N-terminal

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined.

  • Theoretical MW (kDa): 45.54
  • Preparation method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 fast flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Número de acceso AAH18404
Para utilizar con (aplicación) Antibody Production, Protein Array, ELISA, Western Blot
Formulación 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
ID de gen (Entrez) 26291
Peso molecular 45.54
Nombre FGF21 (Human) Recombinant Protein (P01)
Intervalo de pH 8
Método de preparación In vitro wheat germ expression system
Método de purificación Glutathione Sepharose 4 Fast Flow
Pruebas de control de calidad 12.5% SDS-PAGE Stained with Coomassie Blue.
Cantidad 10 μg
Fuente Wheat Germ (in vitro)
Inmunógeno PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Nombre común FGF21
Símbolo de gen FGF21
Reactividad cruzada Human
Especie Wheat Germ (in vitro)
Recombinante Recombinant
Etiqueta de proteína GST
Formulario Solution
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.