Abnova™ FGF21 Recombinant Protein

Human FGF21 full-length ORF recombinant protein with GST-tag at N-terminal

344.00€ - 521.00€

Spezifikation

Número de acceso	AAH18404
Para utilizar con (aplicación)	Antibody Production, Protein Array, ELISA, Western Blot
Formulación	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
ID de gen (Entrez)	26291
Peso molecular	45.54

Mehr Spezifikationen ansehen

Products 2

Produktcode	Marke	Cantidad	Preis	Menge & Verfügbarkeit
Produktcode	Marke	Cantidad	Preis	Menge & Verfügbarkeit
16158292 missing translation for 'viewDocuments' missing translation for 'viewProductCertificates'	Abnova™ H00026291-P01.10ug	10 μg	344.00€ 10 microgramos		Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

16168292 missing translation for 'viewDocuments' missing translation for 'viewProductCertificates'	Abnova™ H00026291-P01.25ug	25 μg	521.00€ 25 microgramos		Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Beschreibung

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined.

Theoretical MW (kDa): 45.54
Preparation method: In vitro wheat germ expression system
Purification: Glutathione Sepharose 4 fast flow
Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spezifikation

Número de acceso	AAH18404
Formulación	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Peso molecular	45.54
Intervalo de pH	8
Método de purificación	Glutathione Sepharose 4 Fast Flow
Fuente	Wheat Germ (in vitro)
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Símbolo de gen	FGF21
Especie	Wheat Germ (in vitro)
Etiqueta de proteína	GST

Para utilizar con (aplicación)	Antibody Production, Protein Array, ELISA, Western Blot
ID de gen (Entrez)	26291
Nombre	FGF21 (Human) Recombinant Protein (P01)
Método de preparación	In vitro wheat germ expression system
Pruebas de control de calidad	12.5% SDS-PAGE Stained with Coomassie Blue.
Inmunógeno	PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Nombre común	FGF21
Reactividad cruzada	Human
Recombinante	Recombinant
Formulario	Solution

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

Zurück zum Seitenanfang

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Abnova™ FGF21 Recombinant Protein

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

Abnova™ FGF21 Recombinant Protein

Spezifikation

Beschreibung

Spezifikation

Dokumentation