missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Fc epsilon RI beta/MS4A2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
359.00€ - 515.00€
Especificaciones
Antígeno | Fc epsilon RI beta/MS4A2 |
---|---|
Dilución | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Clasificación | Polyclonal |
Conjugado | Unconjugated |
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
---|---|---|---|---|---|---|---|---|---|
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
18451452
|
Novus Biologicals
NBP2-31807-25ul |
25 μL |
359.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
18775703
|
Novus Biologicals
NBP2-31807 |
515.00€
0.10 ml |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||||
Descripción
Fc epsilon RI beta/MS4A2 Polyclonal specifically detects Fc epsilon RI beta/MS4A2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Especificaciones
Fc epsilon RI beta/MS4A2 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
Q01362 | |
2206 | |
This antibody was developed against a recombinant protein corresponding to amino acids: EELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPID | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Rabbit | |
Asthma, Immunology, Signal Transduction | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
APY, ATOPY, Fc epsilon receptor I beta-chain, FCER1BIGEL, FCERI, High affinity immunoglobulin epsilon receptor beta-subunit (FcERI) (IgE Fcreceptor, beta-subunit) (Fc epsilon receptor I beta-chain), high affinity immunoglobulin epsilon receptor subunit beta, IgE Fc receptor subunit beta, IgE responsiveness (atopic), IGER, IGHER, immunoglobulin E receptor, high affinity, beta polypeptide, Membrane-spanning 4-domains subfamily A member 2, membrane-spanning 4-domains, subfamily A, member 2 (Fc fragment of IgE, highaffinity I, receptor for; beta polypeptide), MS4A1 | |
MS4A2 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Fc epsilon RI beta/MS4A2 Antibody, Novus Biologicals™