missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Fc epsilon RI beta/MS4A2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-31807-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Fc epsilon RI beta/MS4A2 Polyclonal specifically detects Fc epsilon RI beta/MS4A2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones
| Fc epsilon RI beta/MS4A2 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Q01362 | |
| MS4A2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPID | |
| 25 μL | |
| Asthma, Immunology, Signal Transduction | |
| 2206 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| APY, ATOPY, Fc epsilon receptor I beta-chain, FCER1BIGEL, FCERI, High affinity immunoglobulin epsilon receptor beta-subunit (FcERI) (IgE Fcreceptor, beta-subunit) (Fc epsilon receptor I beta-chain), high affinity immunoglobulin epsilon receptor subunit beta, IgE Fc receptor subunit beta, IgE responsiveness (atopic), IGER, IGHER, immunoglobulin E receptor, high affinity, beta polypeptide, Membrane-spanning 4-domains subfamily A member 2, membrane-spanning 4-domains, subfamily A, member 2 (Fc fragment of IgE, highaffinity I, receptor for; beta polypeptide), MS4A1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Fc epsilon RI beta/MS4A2 Antibody, Novus Biologicals™ > 25 μL, Unlabeled
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido