missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ C1D Recombinant Protein
Marca: Abnova™ H00010438-P02.10ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Especificaciones
| AAH05235 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 41.25 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 10 μg | |
| MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS | |
| MGC12261/MGC14659/SUNCOR | |
| C1D | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 10438 | |
| C1D (Human) Recombinant Protein (P02) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| C1D | |
| Human | |
| Recombinant | |
| Solution |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Abnova™ C1D Recombinant Protein > 10μg
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido