missing translation for 'onlineSavingsMsg'
Learn More
Learn More
U11/U12-35K Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
359.00€ - 515.00€
Especificaciones
Antígeno | U11/U12-35K |
---|---|
Dilución | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Clasificación | Polyclonal |
Conjugado | Unconjugated |
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
---|---|---|---|---|---|---|---|---|---|
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
18648695
|
Novus Biologicals
NBP2-39082-25ul |
25 μL |
359.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
18121278
|
Bio-Techne
NBP2-39082 |
0.1 mL |
515.00€
0.10 ml |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
U11/U12-35K Polyclonal specifically detects U11/U12-35K in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Especificaciones
U11/U12-35K | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
HM1, HM-1, MGC138160, Protein HM-1, small nuclear ribonucleoprotein 35kDa (U11/U12), U1 snRNP-binding protein homolog, U11/U12 small nuclear ribonucleoprotein 35 kDa protein, U11/U12 snRNP 35 kDa protein, U11/U12 snRNP 35K, U11/U12-35K, U1-snRNP binding protein homolog, U1SNRNPBPU1 snRNP binding protein homolog | |
SNRNP35 | |
IgG | |
Affinity Purified |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Rabbit | |
Human | |
Q16560 | |
11066 | |
This antibody was developed against a recombinant protein corresponding to amino acids: LGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERS | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
U11/U12-35K Antibody, Novus Biologicals™