missing translation for 'onlineSavingsMsg'
Learn More
Learn More
U11/U12-35K Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Bio-Techne NBP2-39082
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
U11/U12-35K Polyclonal specifically detects U11/U12-35K in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones
| U11/U12-35K | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Q16560 | |
| SNRNP35 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERS | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| HM1, HM-1, MGC138160, Protein HM-1, small nuclear ribonucleoprotein 35kDa (U11/U12), U1 snRNP-binding protein homolog, U11/U12 small nuclear ribonucleoprotein 35 kDa protein, U11/U12 snRNP 35 kDa protein, U11/U12 snRNP 35K, U11/U12-35K, U1-snRNP binding protein homolog, U1SNRNPBPU1 snRNP binding protein homolog | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 11066 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
U11/U12-35K Antibody, Novus Biologicals™ > 0.1mL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido