missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRUSS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Bio-Techne NBP2-47593
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
TRUSS Polyclonal specifically detects TRUSS in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones
| TRUSS | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| C20orf188, dJ756N5.2, DKFZp586C1223, DKFZP727M231, Protein TAP1, Protein TRUSS, short transient receptor potential channel 4 associated protein, short transient receptor potential channel 4-associated protein, TNF-receptor ubiquitous scaffolding/signaling protein, transient receptor potential cation channel, subfamily C, member 4 associatedprotein, Trp4-associated protein, Trpc4-associated protein, TRRP4APchromosome 20 open reading frame 188, TRUSS, tumor necrosis factor receptor-associated ubiquitous scaffolding and signalingprotein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 26133 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| TRPC4AP | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGK | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
TRUSS Antibody, Novus Biologicals™ > 0.1mL; Unlabeled
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido