missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRUSS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
359.00€ - 515.00€
Especificaciones
Antígeno | TRUSS |
---|---|
Dilución | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
Clasificación | Polyclonal |
Conjugado | Unconjugated |
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
---|---|---|---|---|---|---|---|---|---|
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
18161519
|
Bio-Techne
NBP2-47593 |
0.1 mL |
515.00€
0.10 ml |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
18651846
|
Novus Biologicals
NBP2-47593-25ul |
25 μL |
359.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
TRUSS Polyclonal specifically detects TRUSS in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Especificaciones
TRUSS | |
Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
26133 | |
This antibody was developed against a recombinant protein corresponding to amino acids: LIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGK | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Human | |
C20orf188, dJ756N5.2, DKFZp586C1223, DKFZP727M231, Protein TAP1, Protein TRUSS, short transient receptor potential channel 4 associated protein, short transient receptor potential channel 4-associated protein, TNF-receptor ubiquitous scaffolding/signaling protein, transient receptor potential cation channel, subfamily C, member 4 associatedprotein, Trp4-associated protein, Trpc4-associated protein, TRRP4APchromosome 20 open reading frame 188, TRUSS, tumor necrosis factor receptor-associated ubiquitous scaffolding and signalingprotein | |
TRPC4AP | |
IgG | |
Affinity Purified |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
TRUSS Antibody, Novus Biologicals™