missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human SELE Protein

A cDNA sequence encoding the SELE was constructed and used to recombinantly synthesize the protein.

137.00€ - 3010.00€

Especificaciones

Nombre SELE Protein
Tipo de producto Recombinant Protein
Etiqueta de proteína His
Especie del huésped HEK 293
reactividad cruzada Human
Ver más especificaciones

Productos 3
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
15993599
Ver documentos Detalles de la promoción
enQuireBio™
QP13450-2UG
2 μg
137.00€
2 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 12-07-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
15973599
Ver documentos Detalles de la promoción
enQuireBio™
QP13450-10UG
10 μg
205.00€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 12-07-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
15983599
Ver documentos Detalles de la promoción
enQuireBio™
QP13450-1MG
1 mg
3010.00€
1 miligramo
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 12-07-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

Especificaciones

Especificaciones

SELE Protein
His
Human
Greater than 95% as determined by SDS-PAGE.
Recombinant Protein
HEK 293
WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPVDHHHHHH
SDS
Product Certifications