missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human SELE Protein

A cDNA sequence encoding the SELE was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP13450-10ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15973599

  • 205.00€ / 10 microgramos
Fecha estimada de envío: 12-08-2022
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Especificaciones

Especificaciones

SELE Protein
10 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
His
SELE was lyophilized from a 0.2 microm filtered solution of PBS and 4% Mannitol, pH 7.5.
Greater than 95% as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
HEK 293
WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPVDHHHHHH
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales