missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human SELE Protein

A cDNA sequence encoding the SELE was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP13450-2ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15993599

  • 137.00€ / 2 microgramos
Fecha estimada de envío: 17-08-2022
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Especificaciones

Especificaciones

SELE Protein
2 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
His
SELE was lyophilized from a 0.2 microm filtered solution of PBS and 4% Mannitol, pH 7.5.
Greater than 95% as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
HEK 293
WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPVDHHHHHH
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales