missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ PLUNC Recombinant Protein
Human PLUNC full-length ORF ( AAH12549.1, 1 a.a. - 256 a.a.) recombinant protein with GST-tag at N-terminal
Marca: Abnova™ H00051297-P01.25ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
This gene is the human homolog of murine plunc, and like the mouse gene, is specifically expressed in the upper airways and nasopharyngeal regions. The exact biological function of this gene is not known, however, it has been suggested to be involved in inflammatory responses to irritants in the upper airways. It may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer. Multiple transcript variants resulting from alternative splicing in the 3' UTR have been detected, but the full-length nature of only two is known. (provided by RefSeq)
- Molecular weight: 53.90kDa
- Preparation method: in vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 Fast Flow
- Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH 8 in the elution buffer
- Quality Control Testing: 12.5% SDS-PAGE stained with Coomassie Blue
Best use within three months from the date of receipt of this protein
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Especificaciones
| AAH12549.1 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 53.9 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV | |
| LPLUNC3/LUNX/NASG/SPLUNC1/SPURT/bA49G10.5 | |
| PLUNC | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 51297 | |
| PLUNC (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PLUNC | |
| Human | |
| Recombinant | |
| Solution |