missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ PHB2 Recombinant Protein (P02)
Human PHB2 full-length ORF recombinant protein with GST-tag at N-terminal
Marca: Abnova™ H00011331-P02.10ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Sequence:RESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
Best when used within three months from the date of receipt.ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Especificaciones
AAH14766 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
55 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 μg | |
RESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK | |
BAP/BCAP37/Bap37/MGC117268/PNAS-141/REA/p22 | |
PHB2 | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
11331 | |
PHB2 (Human) Recombinant Protein (P02) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
PHB2 | |
Human | |
Recombinant | |
Solution |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Abnova™ PHB2 Recombinant Protein (P02) > 10μg
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido