missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ MAGEA8 (Human) Recombinant Protein
Human MAGEA8 full-length ORF ( AAH02455, 1 a.a. - 318 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00004107-P01.25ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
- Sequence: MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLGMILMEGSRAPEEAIWEALSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQAPGSDPVRYEFLWGPRALAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV
Especificaciones
| AAH02455 | |
| melanoma antigen family A, 8 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MAGEA8 | |
| GST |
| 4107 | |
| Wheat germ expression system | |
| 25 μg | |
| MAGE8, MGC2182 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Abnova™ MAGEA8 (Human) Recombinant Protein > Quantity: 25 μg
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido