missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ IMPA1 Recombinant Protein

335.00€ - 508.00€

Especificaciones

Número de acceso AAH08381
Para utilizar con (aplicación) Antibody Production, Protein Array, ELISA, Western Blot
Formulación 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
ID de gen (Entrez) 3612
Peso molecular 56.2
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16166881
Ver documentos Detalles de la promoción
Abnova™
H00003612-P01.10UG
10 ug
335.00€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 17-07-2024
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16176881
Ver documentos Detalles de la promoción
Abnova™
H00003612-P01.25UG
25 ug
508.00€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 17-07-2024
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Especificaciones

AAH08381
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
56.2
8
Glutathione Sepharose 4 Fast Flow
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
IMPA1
Human
Recombinant
Solution
Antibody Production, Protein Array, ELISA, Western Blot
3612
IMPA1 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED
IMPA
IMPA1
Wheat Germ (in vitro)
GST
Videos
SDS
Documentos

Documentos

Product Certifications