missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human ZMYM4 (aa 157-240) Control Fragment Recombinant Protein Código de producto.: 30208218

Invitrogen™ Human ZMYM4 (aa 157-240) Control Fragment Recombinant Protein

Código de producto. 30208218
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30208218

Marca: Invitrogen™ RP106574

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65899 (PA5-65899. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Zinc-finger proteins contain DNA-binding domains characterized by the unique role of zinc and have a wide variety of functions such as transcriptional activation or repression. The protein folding and the DNA binding ability are governed by the coordination of a zinc ion. It has been found to be overexpressed in human lung adenocarcinomas and squamous cell carcinomas, and the overexpression of a fragment of the 3'UTR of the ZMYM4 mRNA termed Cell Death Inhibiting RNA (CDIR) protects HeLa cells from IFN-gamma-induced apoptosis, suggesting that ZMYM4 may play a role in tumorigenesis.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q5VZL5
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 9202
Nombre Human ZMYM4 (aa 157-240) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 6330503C17Rik; AI480785; AW493829; CDIR; cell death inhibiting RNA; D630001M21; Kiaa0425; mKIAA0425; MYM; MYM type 4; Zfp262; zinc finger MYM-type containing 4; zinc finger MYM-type protein 4; Zinc finger protein 262; zinc finger, MYM-type 4; Zmym4; ZNF198L3; ZNF262
Nombre común ZMYM4
Símbolo de gen ZMYM4
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LVRENSKETFSGKEKNRDLTYEREKRLDKPHKDLDSRLKSSFFDKAANQVEETLHTHLPQTPETNFRDSSYPFANKESIGSELG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human ZMYM4 (aa 157-240) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado