Learn More
Invitrogen™ Human ZEB1 (aa 565-694) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP100723
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82982 (PA5-82982. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ZEB1 (Zinc finger E-box-binding homeobox 1) acts as a transcriptional repressor. It inhibits interleukin-2 (IL-2) gene expression. ZEB1 enhances or represses the promoter activity of the ATP1A1 gene depending on the quantity of cDNA and depending on the cell type. It represses E-cadherin promoters and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. ZEB1 also represses BCL6 transcription in the presence of the corepressor CTBP1. It postively regulates neuronal differentiation and represses RCOR1 transcription activation during neurogenesis. Mutations in the gene can result in corneal dystrophy, posterior polymorphous and corneal dystrophy, Fuchs endothelial 6.
Especificaciones
P37275 | |
Blocking Assay, Control | |
6935 | |
100 μL | |
[delta]EF1; 3110032K11Rik; AREB6; BZP; Delta EF1; delta-crystallin enhancer binding factor 1; deltaEF1; DELTA-EF1; FECD6; LOW QUALITY PROTEIN: zinc finger E-box-binding homeobox 1; MEB1; MGC133261; Negative regulator of IL2; Nil2; NIL2A; NIL-2 A; NIL-2-A; NIL-2-A zinc finger protein; OTTHUMP00000019405; posterior polymorphous corneal dystrophy 3; PPCD3; RP11-472N13.4; Tcf18; TCF8; TCF-8; Transcription factor 8; transcription factor 8 (represses interleukin 2 expression); Tw; twirler; ZEB; Zeb1; Zfhep; Zfh x 1 A; Zf x 1 A; Zf x 1 ha; zinc finger E-box binding homeobox 1; zinc finger E-box-binding homeobox 1; Zinc finger homeobox protein 1 A; zinc finger homeodomain enhancer-binding protein | |
ZEB1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ZEB1 (aa 565-694) Control Fragment | |
RUO | |
ZEB1 | |
Unconjugated | |
Recombinant | |
EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.