missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human XPB (aa 157-263) Control Fragment Recombinant Protein Código de producto.: 30203757

Invitrogen™ Human XPB (aa 157-263) Control Fragment Recombinant Protein

Código de producto. 30203757
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30203757

Marca: Invitrogen™ RP106107

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65423 (PA5-65423. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The human XPB DNA helicase is a subunit of the DNA repair/basal transcription factor TFIIH, and is involved in early steps of the nucleotide excision repair (NER) pathway. Two distinct clinical phenotypes, xeroderma pigmentosum associated with Cockayne's syndrome (XP/CS) and trichothiodystrophy (TTD), can be due to mutations in the XPB gene.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P19447
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 2071
Nombre Human XPB (aa 157-263) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen Basic transcription factor 2 89 kDa subunit; BTF2; BTF2 p89; BTF2-p89; DNA excision repair protein ERCC-3; DNA repair helicase; DNA repair protein complementing XP-B cells; ERCC excision repair 3, TFIIH core complex helicase subunit; Ercc3; Ercc-3; excision repair 3; excision repair cross-complementation group 3; excision repair cross-complementing rodent repair deficiency, complementation group 3; General transcription and DNA repair factor IIH helicase subunit XPB; GTF2H; RAD25; TFIIH; TFIIH 89 kDa subunit; TFIIH basal transcription factor complex 89 kDa subunit; TFIIH basal transcription factor complex helicase XPB subunit; TFIIH p89; TFIIH subunit XPB; TTD2; Xeroderma pigmentosum group B-complementing protein; xeroderma pigmentosum, complementation group B; XPB; XPBC
Nombre común XPB
Símbolo de gen Ercc3
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia KLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDKDEEEEE
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human XPB (aa 157-263) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado