missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human XPB (aa 157-263) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP106107
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65423 (PA5-65423. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The human XPB DNA helicase is a subunit of the DNA repair/basal transcription factor TFIIH, and is involved in early steps of the nucleotide excision repair (NER) pathway. Two distinct clinical phenotypes, xeroderma pigmentosum associated with Cockayne's syndrome (XP/CS) and trichothiodystrophy (TTD), can be due to mutations in the XPB gene.
Especificaciones
| P19447 | |
| Blocking Assay, Control | |
| 2071 | |
| 100 μL | |
| Basic transcription factor 2 89 kDa subunit; BTF2; BTF2 p89; BTF2-p89; DNA excision repair protein ERCC-3; DNA repair helicase; DNA repair protein complementing XP-B cells; ERCC excision repair 3, TFIIH core complex helicase subunit; Ercc3; Ercc-3; excision repair 3; excision repair cross-complementation group 3; excision repair cross-complementing rodent repair deficiency, complementation group 3; General transcription and DNA repair factor IIH helicase subunit XPB; GTF2H; RAD25; TFIIH; TFIIH 89 kDa subunit; TFIIH basal transcription factor complex 89 kDa subunit; TFIIH basal transcription factor complex helicase XPB subunit; TFIIH p89; TFIIH subunit XPB; TTD2; Xeroderma pigmentosum group B-complementing protein; xeroderma pigmentosum, complementation group B; XPB; XPBC | |
| Ercc3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human XPB (aa 157-263) Control Fragment | |
| RUO | |
| XPB | |
| Unconjugated | |
| Recombinant | |
| KLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDKDEEEEE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human XPB (aa 157-263) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido