Learn More
Invitrogen™ Human VRTN (aa 151-286) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP88860
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51581 (PA5-51581. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
VRTN gene ontology annotations related to this gene include transposition, DNA-mediated.
Especificaciones
Q9H8Y1 | |
Blocking Assay, Control | |
55237 | |
100 μL | |
7420416P09Rik; C14orf115; vertebrae development associated; vertebrae development homolog (pig); vertnin; Vrtn | |
VRTN | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human VRTN (aa 151-286) Control Fragment | |
RUO | |
VRTN | |
Unconjugated | |
Recombinant | |
ATLEAIFDADVKASCFPSSFSNVWHLYALASVLQRNIYSIYPMRNLKIRPYFNRVIRPRRCDHVPSTLHIMWAGQPLTSHFFRHQYFAPVVGLEEVEAEGAPGVAPALPALAPLSSPAKTLELLNREPGLSYSHLC | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.