missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human Ubinuclein 2 (aa 1245-1346) Control Fragment Recombinant Protein Código de producto.: 30194891

Invitrogen™ Human Ubinuclein 2 (aa 1245-1346) Control Fragment Recombinant Protein

Código de producto. 30194891
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30194891

Marca: Invitrogen™ RP92771

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54071 (PA5-54071. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ubinuclein 1 (UBN1) is a ubiquitously expressed evolutionarily conserved protein which binds to proliferation-promoting genes that are repressed by formation of senescence-associated heterochromatin foci (SAHF). Ubinuclein 1 associates with various transcription factors and with histone methyltransferase activity, is indispensable for SAHF formation and appears to be a regulator of senescence. Although in most cells ubinuclein is localized to the nucleus, in cells forming tight junctions it is recruited to the cell adhesion complexes, dependently on the cell density.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q6ZU65
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 254048
Nombre Human Ubinuclein 2 (aa 1245-1346) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2900060J04Rik; 6030408G03Rik; BC060116; D130059P03Rik; Kiaa2030; mKIAA2030; ubinuclein 1; ubinuclein 2; ubinuclein-2; UBN1; UBN2; VT; VT4
Nombre común Ubinuclein 2
Símbolo de gen UBN2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SVTNQNVTPFGMLGGLVPVTMPFQFPLEIFGFGTDTAGVTTTSGSTSAAFHHSLTQNLLKGLQPGGAQHAATLSHSPLPAHLQQAFHDGGQSKGDTKLPRKS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human Ubinuclein 2 (aa 1245-1346) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado