Learn More
Invitrogen™ Human UBE2M (aa 3-84) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP104019
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84357 (PA5-84357. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is linked with a ubiquitin-like protein, NEDD8, which can be conjugated to cellular proteins, such as Cdc53/culin.
Especificaciones
P61081 | |
Blocking Assay, Control | |
9040 | |
100 μL | |
2510040H03Rik; EGK_11185; hUbc12; NEDD8 carrier protein; NEDD8 protein ligase; NEDD8-conjugating enzyme Ubc12; UBC12; UBC12 homolog, yeast; UBC-RS2; Ube2m; ubiquitin C, related sequence 2; ubiquitin carrier protein M; ubiquitin conjugating enzyme E2 M; ubiquitin conjugating enzyme E2M; Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2M; ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast); ubiquitin-protein ligase M; yeast UBC12 homolog | |
UBE2M | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human UBE2M (aa 3-84) Control Fragment | |
RUO | |
UBE2M | |
Unconjugated | |
Recombinant | |
KLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQ | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.