missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human TUBE1 (aa 280-374) Control Fragment Recombinant Protein Código de producto.: 30196672

Invitrogen™ Human TUBE1 (aa 280-374) Control Fragment Recombinant Protein

Código de producto. 30196672
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30196672

Marca: Invitrogen™ RP94620

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56916 (PA5-56916. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Microtubules constitute one of the major components of eukaryotic cells cytoskeleton and are involved in many essential processes, including cell division, ciliary and flagellar motility and intracellular transport. Microtubules of the eukaryotic cytoskeleton are composed of a heterodimer of α- and β-tubulin. In addition to α- and β-tubulin, several other tubulins have been identified, bringing the number of distinct tubulin classes to seven. Most of these tubulins have distinct subcellular localization and an emerging, diverse set of functions.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9UJT0
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 51175
Nombre Human TUBE1 (aa 280-374) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2310061K05Rik; AI551343; dJ142L7.2; epsilon-tubulin; epsilon-tubulin 1; FLJ22589; FLJ44203; RP1-142L7.1; TUBE; Tube1; Tubulin; tubulin epsilon 1; tubulin epsilon chain; tubulin, epsilon 1
Nombre común TUBE1
Símbolo de gen TUBE1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia NMDLNEISMNLVPFPQLHYLVSSLTPLYTLTDVNIPPRRLDQMFSDAFSKDHQLLRADPKHSLYLACALMVRGNVQISDLRRNIERLKPSLQFVS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human TUBE1 (aa 280-374) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado