missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TRIM44 (aa 237-338) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP97434
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-65542 (PA5-65542, PA5-63459 (PA5-63459. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
May play a role in the process of differentiation and maturation of neuronal cells. May regulate the activity of TRIM17.
Especificaciones
| Q96DX7 | |
| Blocking Assay, Control | |
| 54765 | |
| 100 μL | |
| brain cDNA 7; DIPB; DIPB protein; HSA249128; Mc7; Protein DIPB; Protein Mc7; Trim44; tripartite motif containing 44; tripartite motif protein 44; tripartite motif-containing 44; tripartite motif-containing protein 44 | |
| TRIM44 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human TRIM44 (aa 237-338) Control Fragment | |
| RUO | |
| TRIM44 | |
| Unconjugated | |
| Recombinant | |
| LVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGA | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human TRIM44 (aa 237-338) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido