missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human TRIM32 (aa 428-523) Control Fragment Recombinant Protein Código de producto.: 30205775

Invitrogen™ Human TRIM32 (aa 428-523) Control Fragment Recombinant Protein

Código de producto. 30205775
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30205775

Marca: Invitrogen™ RP101224

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62127 (PA5-62127. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRIM32 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM32 localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q13049
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 22954
Nombre Human TRIM32 (aa 428-523) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1810045E12Rik; 3f3; 72 kDa Tat-interacting protein; BBS11; bM468K2.2 (tripartite motif protein 32); E3 ubiquitin-protein ligase TRIM32; HT2A; LGMD2H; RING-type E3 ubiquitin transferase TRIM32; RP11-67K19.1; TAT-interactive protein, 72-KD; TATIP; Trim32; tripartite motif containing 32; tripartite motif protein 32; tripartite motif-containing 32; tripartite motif-containing protein 32; Zfp117; zinc finger protein 117; zinc finger protein HT2A; zinc-finger protein HT2A
Nombre común TRIM32
Símbolo de gen Trim32
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia NLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPSGQFVVTDVEGGKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDA
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human TRIM32 (aa 428-523) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado