missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TRIM2 (aa 343-430) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP96625
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57430 (PA5-57430. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic filaments. Its function has not been identified.
Especificaciones
| Q9C040 | |
| Blocking Assay, Control | |
| 23321 | |
| 100 μL | |
| CMT2R; E3 ubiquitin-protein ligase TRIM2; KIAA0517; mKIAA0517; narf; Neural activity-related RING finger protein; RING finger protein 86; RING-type E3 ubiquitin transferase TRIM2; RNF86; TRIM2; tripartite motif containing 2; tripartite motif protein 2; tripartite motif protein TRIM2; tripartite motif-containing 2; tripartite motif-containing protein 2 | |
| Trim2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human TRIM2 (aa 343-430) Control Fragment | |
| RUO | |
| TRIM2 | |
| Unconjugated | |
| Recombinant | |
| PMSVTITTKDKDGELCKTGNAYLTAELSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPT | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human TRIM2 (aa 343-430) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido