missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human Transketolase (aa 562-623) Control Fragment Recombinant Protein Código de producto.: 30203787

Invitrogen™ Human Transketolase (aa 562-623) Control Fragment Recombinant Protein

Código de producto. 30203787
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Packungsgröße:
100 microlitros
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Código de producto. 30203787

Marca: Invitrogen™ RP92874

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56165 (PA5-56165. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transketolase encodes a thiamine-dependent enzyme which plays a role in the channeling of excess sugar phosphates to glycolysis in the pentose phosphate pathway. Multiple alternatively spliced variants, encoding the same protein, have been identified.
TRUSTED_SUSTAINABILITY

Spezifikation

Número de acceso P29401
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 7086
Nombre Human Transketolase (aa 562-623) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen epididymis luminal protein 107; epididymis secretory protein Li 48; HEL107; HEL-S-48; p68; TK; TKT; TKT1; Transketolase; transketolase (Wernicke-Korsakoff syndrome)
Nombre común Transketolase
Símbolo de gen TKT
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia HYYEGGIGEAVSSAVVGEPGITVTHLAVNRVPRSGKPAELLKMFGIDRDAIAQAVRGLITKA
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts
Invitrogen™ Human Transketolase (aa 562-623) Control Fragment Recombinant Protein >

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt