missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TOM1 Partial ORF (NP_005479, 394 a.a. - 491 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifications
| Número de acceso | NP_005479 |
|---|---|
| Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID de gen (Entrez) | 10043 |
| Peso molecular | 36.52kDa |
| Product Code | Brand | Cantidad | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Cantidad | Price | Quantity & Availability | |||||
|
16191696
|
Abnova™
H00010043-Q01.25UG |
25 ug |
508.00€
25 microgramos |
Fecha estimada de envío: 05-06-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
|
16181696
|
Abnova™
H00010043-Q01.10UG |
10 ug |
335.00€
10 microgramos |
Fecha estimada de envío: 05-06-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Description
This gene was identified as a target of the v-myb oncogene. The encoded protein shares its N-terminal domain in common with proteins associated with vesicular trafficking at the endosome. It is recruited to the endosomes by its interaction with endofin. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: GLAGALDARQQSTGAIPVTQACLMEDIEQWLSTDVGNDAEEPKGVTSEEFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLFASpecifications
| NP_005479 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.52kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ33404 | |
| TOM1 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 10043 | |
| TOM1 (Human) Recombinant Protein (Q01) | |
| GLAGALDARQQSTGAIPVTQACLMEDIEQWLSTDVGNDAEEPKGVTSEEFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLFA | |
| RUO | |
| TOM1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |