Learn More
Invitrogen™ Human TMEM106B (aa 2-53) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP100479
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63558 (PA5-63558. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Transmembrane protein 106B (TMEM106B) is a single-pass transmembrane protein that is thought to be a novel risk factor for frontotemporal lobar degeneration (FTLD), a group of clinically, pathologically and genetically heterogeneous disorders associated with atrophy in the frontal lobe and temporal lobe of the brain. The actual role of TMEM106B, and that of the closely related protein TMEM106A are still undetermined.
Especificaciones
Q9NUM4 | |
Blocking Assay, Control | |
54664 | |
100 μL | |
2310036D22Rik; 5830455K21Rik; 6430519M21Rik; AI428776; AI661344; hypothetical protein LOC508903; LRRGT00101; tmem106b; tmem106bb; Transmembrane protein 106 B; transmembrane protein 106 Bb; zgc:114147 | |
TMEM106B | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human TMEM106B (aa 2-53) Control Fragment | |
RUO | |
TMEM106B | |
Unconjugated | |
Recombinant | |
GKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVSQFPYVEF | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.