Learn More
Abnova™ Human TFAP2B Partial ORF (NP_003212, 73 a.a. - 182 a.a.) Recombinant Protein with GST-tag at N-terminal
Descripción
This gene encodes a member of the AP-2 family of transcription factors. AP-2 proteins form homo- or hetero-dimers with other AP-2 family members and bind specific DNA sequences. They are thought to stimulate cell proliferation and suppress terminal differentiation of specific cell types during embryonic development. Specific AP-2 family members differ in their expression patterns and binding affinity for different promoters. This protein functions as both a transcriptional activator and repressor. Mutations in this gene result in autosomal dominant Char syndrome, suggesting that this gene functions in the differentiation of neural crest cell derivatives. [provided by RefSeq]
Especificaciones
Especificaciones
Número de acceso | NP_003212 |
Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
ID de gen (Entrez) | 7021 |
Peso molecular | 37.84kDa |
Nombre | TFAP2B (Human) Recombinant Protein (Q01) |
Pruebas de control de calidad | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Cantidad | 25 ug |
Inmunógeno | DPYSHVNDPYSLNPLHQPQQHPWGQRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNSGMNLL |
Requisitos de almacenamiento | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Mostrar más |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.