missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human TFAM (aa 171-244) Control Fragment Recombinant Protein Código de producto.: 30208189

Invitrogen™ Human TFAM (aa 171-244) Control Fragment Recombinant Protein

Código de producto. 30208189
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30208189

Marca: Invitrogen™ RP105270

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mitochondrial transcription factor A (TFAM) is a crucial protein encoded by nuclear genes, but it is transported from the cytoplasm to mitochondria where it plays a key role in the maintenance and expression of mitochondrial DNA (mtDNA). It regulates the replication and transcription of mtDNA, ensuring the proper functioning of mitochondrial processes. Structurally, TFAM contains a molecular region known as the LC3 interacting region (LIR) motif, which allows it to bind to autophagy proteins such as LC3. This interaction is essential for the autolysosomal pathway, helping to eliminate leaked mtDNA and limit inflammation. TFAM levels vary across tissues, with notable effects on mitochondrial function; high levels can repress mtDNA expression in certain tissues, such as skeletal muscle, and contribute to deficiencies in oxidative phosphorylation (OXPHOS). Conversely, in other tissues like the heart, increased mtDNA copy number maintains a balanced TFAM-to-mtDNA ratio, preserving OXPHOS capacity. TFAM is integral to the packaging, stability, and replication of the mitochondrial genome, and disruptions in TFAM can have severe effects, including implications in neurodegeneration and other diseases related to mtDNA stress.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q00059
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 7019
Nombre Human TFAM (aa 171-244) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AI661103; Hmgts; Mitochondrial transcription factor 1; mitochondrial transcription factor A; MTTF1; mtTFA; TCF6; TCF-6; TCF6L1; TCF6L2; TCF6L3; Testis-specific high mobility group protein; testis-specific HMG-box protein m-tsHMG; TFAM; Transcription factor 6; transcription factor 6-like 1; transcription factor 6-like 2; transcription factor 6-like 2 (mitochondrial transcription factor); transcription factor 6-like 3; transcription factor A, mitochondrial; tsHMG; TS-HMG
Nombre común TFAM
Símbolo de gen Tfam
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia QEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAE
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human TFAM (aa 171-244) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado