missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TEX15 (aa 756-862) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP105927
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65179 (PA5-65179. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Required during spermatogenesis for normal chromosome synapsis and meiotic recombination in germ cells. Necessary for formation of DMC1 and RAD51 foci on meiotic chromosomes, suggesting a specific role in DNA double-stranded break repair.
Especificaciones
| Q9BXT5 | |
| Blocking Assay, Control | |
| 56154 | |
| 100 μL | |
| 2210014E14Rik; AL022622; AU022940; cancer/testis antigen 42; CT42; testis expressed 15; testis expressed gene 15; Testis-expressed protein 15; testis-expressed sequence 15 protein; TE x 15 | |
| TEX15 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human TEX15 (aa 756-862) Control Fragment | |
| RUO | |
| TEX15 | |
| Unconjugated | |
| Recombinant | |
| STQNNETELTSPILLPDLQIKITNIFRPGFSPTADSLALKDSFCTHVTEATKPEINKEDGEILGFDIYSQPFGENADYPCEDKVDNIRQESGPVSNSEISLSFDLSR | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human TEX15 (aa 756-862) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido